PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G29770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 393aa    MW: 41732.5 Da    PI: 8.5535
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G29770.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789.3e-25125169145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  OGLUM02G29770.1 125 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVET 169
                      79****************************************997 PP

2QLQ60.93.5e-216499237
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     +FTaaQ ++L++Q+l+yKyL+a++PvPp+L+++i++
  OGLUM02G29770.1 64 PFTAAQYEELEQQALIYKYLVAGVPVPPDLVLPIRR 99
                     9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.7E-116399IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.7E-156498IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.8796499IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.486125169IPR014977WRC domain
PfamPF088794.0E-21126168IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MAMPYASLSP AVADHRSSPA AATASLLPFC RSTPLSAGGG GVAMGEDAPM TARWPPAAAA  60
RLPPFTAAQY EELEQQALIY KYLVAGVPVP PDLVLPIRRG LDSLAARFYN HPALGYGPYF  120
GKKLDPEPGR CRRTDGKKWR CSKEAAPDSK YCERHMHRGR NRSRKPVETQ LVAQSQPPSA  180
VVGSAAAPLA AASNGSFQNH SLYPAIAGSN GGGGGRNMPS SFGSALGSQL HMDNAAPYAA  240
VGGGTGKDLR YTAYGTRSLA DEQSQLITEA INTSIENPWR LLPSQNSPFP LSSYSQLGAL  300
SDLGQNTPSS LSKVQRQPLS FFGNDYAAVD SVKQENQTLR PFFDEWPKGR DSWSDLADEN  360
ANLSSFSGTQ LSISIPMASS DFSAASSRST NGD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0639830.0AK063983.1 Oryza sativa Japonica Group cDNA clone:001-124-D07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624297.10.0PREDICTED: growth-regulating factor 4
SwissprotQ6ZIK50.0GRF4_ORYSJ; Growth-regulating factor 4
TrEMBLA0A0D9YWY70.0A0A0D9YWY7_9ORYZ; Uncharacterized protein
STRINGBGIOSGA005785-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-46growth-regulating factor 5